PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G536000.1.p
Common NameLOC101777578, SETIT_035742mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 441aa    MW: 49489 Da    PI: 10.0285
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G536000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.61.2e-07132174346
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         +W+ eE ++l ++++++  + +  Ia +++++R+ +++ksr+++
  Seita.9G536000.1.p 132 AWSREETDQLFELCERFDLR-FIVIADRFPTTRSVEDLKSRYYS 174
                         7*******************.*********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF162826.7E-31105179IPR032563DAMP1, SANT/Myb-like domain
SMARTSM007173.0E-7129178IPR001005SANT/Myb domain
SuperFamilySSF466893.67E-6129183IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.9E-5132177IPR009057Homeodomain-like
CDDcd116587.92E-18133175No hitNo description
PfamPF054996.8E-7311374IPR008468DNA methyltransferase 1-associated 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0000812Cellular ComponentSwr1 complex
GO:0035267Cellular ComponentNuA4 histone acetyltransferase complex
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
MDAKDILGLP KTPFSTSQEK KSRPPKEPQR KPDGVSREVY ALTGGVGMAP LMPTIEASHL  60
KRRPAAEKEK VAWQWLPFTS SARSDNLQLY HWVRVVNGVP PTGDYQFAKY NKKVDVLKYT  120
DEEYEKYLID PAWSREETDQ LFELCERFDL RFIVIADRFP TTRSVEDLKS RYYSVSRSLL  180
IHRARSFDDV SGNPLVKDSY DAAHETERKR ALSALLSQTK QQERKDAETL AEAKRIMESR  240
AASKNLDEAG MPSSSDNAMV PVDGVSPLSG THPPLTHPNT AANSSIPNSL RTLRVYLRTH  300
ALDQMVQAAS ASAGLRVIKR VDQTLQDLGV NLKPKVPTKA VCVEHLELRN EILTLLNLQK  360
QLQNKEAEVS ANRESSFTEA PSTPKRSNRD IDRTFIPDTI GFSGERAGKR DHKRKTTGRF  420
IDAPPSPTQS KRPRKLKGSD *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3hm5_A3e-20104179483DNA methyltransferase 1-associated protein 1
4iej_A3e-20104179483DNA methyltransferase 1-associated protein 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9684390.0EU968439.1 Zea mays clone 320860 DNA methyltransferase 1-associated protein 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985656.10.0PREDICTED: SWR1-complex protein 4-like
SwissprotQ8VZL60.0SWC4_ARATH; SWR1-complex protein 4
TrEMBLK4AA360.0K4AA36_SETIT; Uncharacterized protein
STRINGSi035742m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61531216
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47210.10.0MYB_related family protein